PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS61270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family WOX
Protein Properties Length: 176aa    MW: 20625.1 Da    PI: 7.5067
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS61270.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.18.2e-20362357
                --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                +R+++t+eql++Lee ++   r+ps e+++ + +kl    +++ ++V++WFqN++a+ek+
  EPS61270.1  3 TRWSPTPEQLQTLEEIYRHgVRTPSPEQIQSIVSKLrrfgRIEGKNVFYWFQNHKAREKQ 62
                8*****************99**************************************97 PP

2Wus_type_Homeobox109.51.9e-35264365
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +tRW+PtpeQ++ Lee+y++G+rtP+ e+iq i ++L+++G+ie+kNVfyWFQN+kaRe+q++
         EPS61270.1  2 NTRWSPTPEQLQTLEEIYRHGVRTPSPEQIQSIVSKLRRFGRIEGKNVFYWFQNHKAREKQRK 64
                       69***********************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.386163IPR001356Homeobox domain
SMARTSM003893.8E-4167IPR001356Homeobox domain
CDDcd000862.55E-5364No hitNo description
SuperFamilySSF466894.28E-12366IPR009057Homeodomain-like
PfamPF000461.7E-17362IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.4E-9362IPR009057Homeodomain-like
PROSITE patternPS0061601226IPR033379Histidine acid phosphatase active site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MNTRWSPTPE QLQTLEEIYR HGVRTPSPEQ IQSIVSKLRR FGRIEGKNVF YWFQNHKARE  60
KQRKRRRLEL QDFYALQQRK WCSGGIDQSS DFKNHYQAAA AQTPCCWPLE EFFTAQKGSE  120
TAARKTLDLF PIVPFRAAAG KEENHDDDDD DDGISEMAKP VPNQFFEFLP IPAREF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16266RKRRR
26367KRRRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012844100.16e-32PREDICTED: WUSCHEL-related homeobox 6-like
TrEMBLS8C3671e-131S8C367_9LAMI; Uncharacterized protein
STRINGVIT_17s0000g02460.t018e-30(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46812342
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01500.13e-27WOX family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]